FAM35A Rabbit Polyclonal Antibody TA344822 from OriGene Technologies | Biocompare.com

Supplier Images

FAM35A Rabbit Polyclonal Antibody

Be the first to write a review!

Supplier Page from
OriGene Technologies for
FAM35A Rabbit Polyclonal Antibody

The FAM35A Rabbit Polyclonal Antibody from OriGene Technologies is a Rabbit Polyclonal antibody to SHLD2. This antibody recognizes Human antigen. The FAM35A Rabbit Polyclonal Antibody has been validated for the following applications: Western Blot.

Description

Rabbit Polyclonal Anti-FAM35A Antibody - N-terminal region

Product Specs
ItemFAM35A Rabbit Polyclonal Antibody
CompanyOriGene Technologies
Price Pricing Info Supplier Page View Company Product Page
Catalog NumberTA344822
Quantity100 µl
ApplicationsWB
Conjugate/TagUnconjugated
PurityAffinity Purified
ReactivityHuman
TargetSHLD2
IsotypeIgG
HostRabbit
Antibody TypePrimary Antibodies
ImmunogenThe immunogen for anti-FAM35A antibody: synthetic peptide directed towards the N terminal of human FAM35A. Synthetic peptide located within the following region: PDLSGHFLANCMNRHVHVKDDFVRSVSETQNIESQKIHSSRLSDITSSNM
NCBI Full Gene Nameshieldin complex subunit 2
NCBI Gene AliasesRINN2, FAM35A, FAM35A1, bA163M19.1
ClonalityPolyclonal
TypePrimary Antibodies
FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.

Add to Compare List

OriGene Technologies

OriGene Technologies

9620 Medical Center Drive # 200

Rockville, Maryland 20850

United States

Phone: 1-888-267-4436 (U.S. only) / 301-340-3188
301-340-9254

Company Profile

Website: http://www.origene.com

Be the First to Write a Review!